Definition of the word expert

Recent Examples on the Web



What about other experts?


Kenny Jacoby, USA TODAY, 31 Mar. 2023





Along with other experts at the Good Housekeeping Institute, she’s been testing the Loftie alarm clock in her bedroom for the past few weeks, falling asleep to crickets (not car horns) and waking up with a smile on her face to a peaceful gong.


Good Housekeeping, 31 Mar. 2023





For instance, experts said the decision would not overturn coverage for preventive women’s health services that were approved outside the task force.


Paul J. Weber, Fortune, 31 Mar. 2023





The forest fire that that broke out last Thursday near the village of Villanueva de Viver surprised Rubio and fire experts by displaying an unusual ferocity for spring, when in previous years lower temperatures helped keep fires manageable.


Joseph Wilson, ajc, 30 Mar. 2023





The jury also heard from witnesses on the mountain with Paltrow and Sanderson that day, such as Craig Ramon and Deer Valley Resort ski instructor Eric Christiansen, as well as experts who investigated the collision.


Tommy Mcardle, Peoplemag, 30 Mar. 2023





But tethering your heart to software comes with severe risks, computer science and public health experts said.


Pranshu Verma, Washington Post, 30 Mar. 2023





The meeting reflected a move by some gunmakers at the time to strike licensing agreements with gaming firms to feature certain firearms, according to lawyers and experts, along with interviews and documents obtained by The Post.


Todd C. Frankel, Shawn Boburg, Josh Dawsey, Ashley Parker And Alex Horton, The Washington Post, Anchorage Daily News, 30 Mar. 2023





And on April 7, the gallery will screen Riggs’ whimsical 1931 film A Day in Santa Fe, followed by a panel discussion with Smith and other experts.


Jennie Rothenberg Gritz, Smithsonian Magazine, 30 Mar. 2023




The Tequesta were expert fishers who stretched nets across the Miami River and built barriers to funnel fish into their clutches.


Sean Kingsley, Smithsonian Magazine, 29 Mar. 2023





Specifically, Avedon was expert at folding naturalism into artifice and maximizing the volume of both.


Sebastian Smee, Washington Post, 25 Mar. 2023





Plus, keep reading for expert advice on how to use derma rollers to get the best results.


ELLE, 24 Mar. 2023





Sanderson’s attorneys and expert medical witnesses described how his injuries were likely caused by someone crashing into him from behind.


Sam Metz, ajc, 24 Mar. 2023





Putnam built studios to his expert specifications and fitted them with tech-forward recording equipment.


Lily Moayeri, Variety, 22 Mar. 2023





Building a vision and purpose for your wealth is a journey that can last a lifetime and can require expert advice adaptable to change—but these are central to delivering a long-lasting legacy, which is more than just passing on money or property.


Standard Chartered Bank, Forbes, 16 Mar. 2023





The theatrical craftsmanship is typically expert.


Brian Seibert, New York Times, 2 Mar. 2023





Patients can ask their doctor to call the county Health Department to get connected to toxicologists who can provide expert advice, Vanderhoff said.


Aya Elamroussi, CNN, 23 Feb. 2023




According to the Louisville National Weather Service, a heat wave that began in earnest Monday afternoon is the result of dry southern winds descending on the area, and residents should expert temperatures between 90 and 100 throughout the coming weeks.


Thomas Birmingham, The Courier-Journal, 13 June 2022





Toby Grey contributes as a How To expert for BGR.


Toby Grey, BGR, 24 May 2022





Medium-impact activities are somewhere in between, such as more intense cycling, intermediate to expert hikes and elliptical training, to name a few.


Nicola Fumo, The Hollywood Reporter, 20 Jan. 2023





Rather than a full head of highlights distributed uniformly through the hair, French women prefer to get their hair colored with a more freestyle (but still expert) touch.


Hannah Coates, Vogue, 3 Jan. 2023





Its slopes, which cover 1,200 acres, are considered advanced to expert backcountry routes.


Doha Madani, NBC News, 27 Dec. 2022





But to expert observers, that seemed complex — and worth seeking specifics to understand what was a significant change in business and what was simply rhetoric, perhaps helpful in the height of 2020 protests but lacking lasting financial impact.


Emily Flitter, New York Times, 21 Oct. 2022





And number two, everyone in this city is a savant or expert on one very specific thing.


Los Angeles Times, 16 Nov. 2022





In finding the best dog treats, our product experts sifted through countless five-star options, chatted with real pet parents and spoke to expert Megan Conrad, MBBS, a veterinarian at Hello Ralphie and associate vet at WellHaven Pet Health.


Jamie Spain, Good Housekeeping, 1 Nov. 2022



See More

These examples are programmatically compiled from various online sources to illustrate current usage of the word ‘expert.’ Any opinions expressed in the examples do not represent those of Merriam-Webster or its editors. Send us feedback about these examples.

An expert is somebody who has a broad and deep understanding and competence in terms of knowledge, skill and experience through practice and education in a particular field. Informally, an expert is someone widely recognized as a reliable source of technique or skill whose faculty for judging or deciding rightly, justly, or wisely is accorded authority and status by peers or the public in a specific well-distinguished domain. An expert, more generally, is a person with extensive knowledge or ability based on research, experience, or occupation and in a particular area of study. Experts are called in for advice on their respective subject, but they do not always agree on the particulars of a field of study. An expert can be believed, by virtue of credentials, training, education, profession, publication or experience, to have special knowledge of a subject beyond that of the average person, sufficient that others may officially (and legally) rely upon the individual’s opinion on that topic. Historically, an expert was referred to as a sage. The individual was usually a profound thinker distinguished for wisdom and sound judgment.

In specific fields, the definition of expert is well established by consensus and therefore it is not always necessary for individuals to have a professional or academic qualification for them to be accepted as an expert. In this respect, a shepherd with 50 years of experience tending flocks would be widely recognized as having complete expertise in the use and training of sheep dogs and the care of sheep. Another example from computer science is that an expert system may be taught by a human and thereafter considered an expert, often outperforming human beings at particular tasks. In law, an expert witness must be recognized by argument and authority.

Research in this area attempts to understand the relation between expert knowledge, skills and personal characteristics and exceptional performance. Some researchers have investigated the cognitive structures and processes of experts. The fundamental aim of this research is to describe what it is that experts know and how they use their knowledge to achieve performance that most people assume requires extreme or extraordinary ability. Studies have investigated the factors that enable experts to be fast and accurate.[1]

Expertise[edit]

Expertise characteristics, skills and knowledge of a person (that is, expert) or of a system, which distinguish experts from novices and less experienced people. In many domains there are objective measures of performance capable of distinguishing experts from novices: expert chess players will almost always win games against recreational chess players; expert medical specialists are more likely to diagnose a disease correctly; etc.

The word expertise is used to refer also to expert determination, where an expert is invited to decide a disputed issue. The decision may be binding or advisory, according to the agreement between the parties in dispute.

Academic views[edit]

There are two academic approaches to the understanding and study of expertise. The first understands expertise as an emergent property of communities of practice. In this view expertise is socially constructed; tools for thinking and scripts for action are jointly constructed within social groups enabling that group jointly to define and acquire expertise in some domain.

In the second view, expertise is a characteristic of individuals and is a consequence of the human capacity for extensive adaptation to physical and social environments. Many accounts of the development of expertise emphasize that it comes about through long periods of deliberate practice. In many domains of expertise estimates of 10 years’ experience[2] deliberate practice are common. Recent research on expertise emphasizes the nurture side of the nature and nurture argument.[2] Some factors not fitting the nature-nurture dichotomy are biological but not genetic, such as starting age, handedness, and season of birth.[3][4][5]

In the field of education there is a potential «expert blind spot» (see also Dunning–Kruger effect) in newly practicing educators who are experts in their content area. This is based on the «expert blind spot hypothesis» researched by Mitchell Nathan and Andrew Petrosino.[6] Newly practicing educators with advanced subject-area expertise of an educational content area tend to use the formalities and analysis methods of their particular area of expertise as a major guiding factor of student instruction and knowledge development, rather than being guided by student learning and developmental needs that are prevalent among novice learners.

The blind spot metaphor refers to the physiological blind spot in human vision in which perceptions of surroundings and circumstances are strongly impacted by their expectations. Beginning practicing educators tend to overlook the importance of novice levels of prior knowledge and other factors involved in adjusting and adapting pedagogy for learner understanding. This expert blind spot is in part due to an assumption that novices’ cognitive schemata are less elaborate, interconnected, and accessible than experts’ and that their pedagogical reasoning skills are less well developed.[7] Essential knowledge of subject matter for practicing educators consists of overlapping knowledge domains: subject matter knowledge and pedagogical content matter.[8] Pedagogical content matter consists of an understanding of how to represent certain concepts in ways appropriate to the learner contexts, including abilities and interests. The expert blind spot is a pedagogical phenomenon that is typically overcome through educators’ experience with instructing learners over time.[9][10]

Historical views[edit]

In line with the socially constructed view of expertise, expertise can also be understood as a form of power; that is, experts have the ability to influence others as a result of their defined social status. By a similar token, a fear of experts can arise from fear of an intellectual elite’s power. In earlier periods of history, simply being able to read made one part of an intellectual elite. The introduction of the printing press in Europe during the fifteenth century and the diffusion of printed matter contributed to higher literacy rates and wider access to the once-rarefied knowledge of academia. The subsequent spread of education and learning changed society, and initiated an era of widespread education whose elite would now instead be those who produced the written content itself for consumption, in education and all other spheres.

Plato’s «Noble Lie», concerns expertise. Plato did not believe most people were clever enough to look after their own and society’s best interest, so the few clever people of the world needed to lead the rest of the flock. Therefore, the idea was born that only the elite should know the truth in its complete form and the rulers, Plato said, must tell the people of the city «the noble lie» to keep them passive and content, without the risk of upheaval and unrest.

In contemporary society, doctors and scientists, for example, are considered to be experts in that they hold a body of dominant knowledge that is, on the whole, inaccessible to the layman.[11] However, this inaccessibility and perhaps even mystery that surrounds expertise does not cause the layman to disregard the opinion of the experts on account of the unknown. Instead, the complete opposite occurs whereby members of the public believe in and highly value the opinion of medical professionals or of scientific discoveries,[11] despite not understanding it.

[edit]

A number of computational models have been developed in cognitive science to explain the development from novice to expert. In particular, Herbert A. Simon and Kevin Gilmartin proposed a model of learning in chess called MAPP (Memory-Aided Pattern Recognizer).[12] Based on simulations, they estimated that about 50,000 chunks (units of memory) are necessary to become an expert, and hence the many years needed to reach this level. More recently, the CHREST model (Chunk Hierarchy and REtrieval STructures) has simulated in detail a number of phenomena in chess expertise (eye movements, performance in a variety of memory tasks, development from novice to expert) and in other domains.[13][14]

An important feature of expert performance seems to be the way in which experts are able to rapidly retrieve complex configurations of information from long-term memory. They recognize situations because they have meaning. It is perhaps this central concern with meaning and how it attaches to situations which provides an important link between the individual and social approaches to the development of expertise. Work on «Skilled Memory and Expertise» by Anders Ericsson and James J. Staszewski confronts the paradox of expertise and claims that people not only acquire content knowledge as they practice cognitive skills, they also develop mechanisms that enable them to use a large and familiar knowledge base efficiently.[1]

Work on expert systems (computer software designed to provide an answer to a problem, or clarify uncertainties where normally one or more human experts would need to be consulted) typically is grounded on the premise that expertise is based on acquired repertoires of rules and frameworks for decision making which can be elicited as the basis for computer supported judgment and decision-making. However, there is increasing evidence that expertise does not work in this fashion. Rather, experts recognize situations based on experience of many prior situations. They are in consequence able to make rapid decisions in complex and dynamic situations.

In a critique of the expert systems literature, Dreyfus & Dreyfus suggest:

If one asks an expert for the rules he or she is using, one will, in effect, force the expert to regress to the level of a beginner and state the rules learned in school. Thus, instead of using rules he or she no longer remembers, as the knowledge engineers suppose, the expert is forced to remember rules he or she no longer uses. … No amount of rules and facts can capture the knowledge an expert has when he or she has stored experience of the actual outcomes of tens of thousands of situations.[15]

Skilled memory theory[edit]

The role of long-term memory in the skilled memory effect was first articulated by Chase and Simon in their classic studies of chess expertise. They asserted that organized patterns of information stored in long-term memory (chunks) mediated experts’ rapid encoding and superior retention. Their study revealed that all subjects retrieved about the same number of chunks, but the size of the chunks varied with subjects’ prior experience. Experts’ chunks contained more individual pieces than those of novices. This research did not investigate how experts find, distinguish, and retrieve the right chunks from the vast number they hold without a lengthy search of long-term memory.

Skilled memory enables experts to rapidly encode, store, and retrieve information within the domain of their expertise and thereby circumvent the capacity limitations that typically constrain novice performance. For example, it explains experts’ ability to recall large amounts of material displayed for only brief study intervals, provided that the material comes from their domain of expertise. When unfamiliar material (not from their domain of expertise) is presented to experts, their recall is no better than that of novices.

The first principle of skilled memory, the meaningful encoding principle, states that experts exploit prior knowledge to durably encode information needed to perform a familiar task successfully. Experts form more elaborate and accessible memory representations than novices. The elaborate semantic memory network creates meaningful memory codes that create multiple potential cues and avenues for retrieval.

The second principle, the retrieval structure principle states that experts develop memory mechanisms called retrieval structures to facilitate the retrieval of information stored in long-term memory. These mechanisms operate in a fashion consistent with the meaningful encoding principle to provide cues that can later be regenerated to retrieve the stored information efficiently without a lengthy search.

The third principle, the speed up principle states that long-term memory encoding and retrieval operations speed up with practice, so that their speed and accuracy approach the speed and accuracy of short-term memory storage and retrieval.

Examples of skilled memory research described in the Ericsson and Stasewski study include:[1]

  • a waiter who can accurately remember up to 20 complete dinner orders in an actual restaurant setting by using mnemonic strategy, patterns, and spatial relations (position of the person ordering). At the time of recall all items of a category (e.g., all salad dressings, then all meat temperatures, then all steak types, then all starch type) would be recalled in clockwise for all customers.
  • a running enthusiast who grouped together short random sequences of digits and encoded the groups in terms of their meaning as running times, dates, and ages. He was thus able to recall over 84% of all digit groups presented in a session totaling 200–300 digits. His expertise was limited to digits; when a switch from digits to letters of the alphabet was made he exhibited no transfer—his memory span dropped back to about six consonants.
  • math enthusiasts who can in less than 25 seconds mentally solve 2 × 5 digit multiplication problems (e.g., 23 × 48,856) that have been presented orally by the researcher.

In problem solving[edit]

Much of the research regarding expertise involves the studies of how experts and novices differ in solving problems.[16] Mathematics[17] and physics[18] are common domains for these studies.

One of the most cited works in this area examines how experts (PhD students in physics) and novices (undergraduate students that completed one semester of mechanics) categorize and represent physics problems. They found that novices sort problems into categories based upon surface features (e.g., keywords in the problem statement or visual configurations of the objects depicted). Experts, however, categorize problems based upon their deep structures (i.e., the main physics principle used to solve the problem).[19]

Their findings also suggest that while the schemas of both novices and experts are activated by the same features of a problem statement, the experts’ schemas contain more procedural knowledge which aid in determining which principle to apply, and novices’ schemas contain mostly declarative knowledge which do not aid in determining methods for solution.[19]

Germain’s scale[edit]

Relative to a specific field, an expert has:

  • Specific education, training, and knowledge
  • Required qualifications
  • Ability to assess importance in work-related situations
  • Capability to improve themselves
  • Intuition
  • Self-assurance and confidence in their knowledge

Marie-Line Germain developed a psychometric measure of perception of employee expertise called the Generalized Expertise Measure.[20] She defined a behavioral dimension in experts, in addition to the dimensions suggested by Swanson and Holton.[21] Her 16-item scale contains objective expertise items and subjective expertise items. Objective items were named Evidence-Based items. Subjective items (the remaining 11 items from the measure below) were named Self-Enhancement items because of their behavioral component.[20]

  • This person has knowledge specific to a field of work.
  • This person shows they have the education necessary to be an expert in the field.
  • This person has the qualifications required to be an expert in the field.
  • This person has been trained in their area of expertise.
  • This person is ambitious about their work in the company.
  • This person can assess whether a work-related situation is important or not.
  • This person is capable of improving themselves.
  • This person is charismatic.
  • This person can deduce things from work-related situations easily.
  • This person is intuitive in the job.
  • This person is able to judge what things are important in their job.
  • This person has the drive to become what they are capable of becoming in their field.
  • This person is self-assured.
  • This person has self-confidence.
  • This person is outgoing.

Rhetoric[edit]

Scholars in rhetoric have also turned their attention to the concept of the expert. Considered an appeal to ethos or «the personal character of the speaker»,[22] established expertise allows a speaker to make statements regarding special topics of which the audience may be ignorant. In other words, the expert enjoys the deference of the audience’s judgment and can appeal to authority where a non-expert cannot.

In The Rhetoric of Expertise, E. Johanna Hartelius defines two basic modes of expertise: autonomous and attributed expertise. While an autonomous expert can «possess expert knowledge without recognition from other people,» attributed expertise is «a performance that may or may not indicate genuine knowledge.» With these two categories, Hartelius isolates the rhetorical problems faced by experts: just as someone with autonomous expertise may not possess the skill to persuade people to hold their points of view, someone with merely attributed expertise may be persuasive but lack the actual knowledge pertaining to a given subject. The problem faced by audiences follows from the problem facing experts: when faced with competing claims of expertise, what resources do non-experts have to evaluate claims put before them?[23]

Dialogic expertise[edit]

Hartelius and other scholars have also noted the challenges that projects such as Wikipedia pose to how experts have traditionally constructed their authority. In «Wikipedia and the Emergence of Dialogic Expertise», she highlights Wikipedia as an example of the «dialogic expertise» made possible by collaborative digital spaces. Predicated upon the notion that «truth emerges from dialogue», Wikipedia challenges traditional expertise both because anyone can edit it and because no single person, regardless of their credentials, can end a discussion by fiat. In other words, the community, rather than single individuals, direct the course of discussion. The production of knowledge, then, as a process of dialogue and argumentation, becomes an inherently rhetorical activity.[24]

Hartelius calls attention to two competing norm systems of expertise: “network norms of dialogic collaboration” and “deferential norms of socially sanctioned professionalism”; Wikipedia being evidence of the first.[25] Drawing on a Bakhtinian framework, Hartelius posits that Wikipedia is an example of an epistemic network that is driven by the view that individuals’ ideas clash with one another so as to generate expertise collaboratively.[25] Hartelius compares Wikipedia’s methodology of open-ended discussions of topics to that of Bakhtin’s theory of speech communication, where genuine dialogue is considered a live event, which is continuously open to new additions and participants.[25] Hartelius acknowledges that knowledge, experience, training, skill, and qualification are important dimensions of expertise but posits that the concept is more complex than sociologists and psychologists suggest.[25] Arguing that expertise is rhetorical, then, Hartelius explains that expertise «is not simply about one person’s skills being different from another’s. It is also fundamentally contingent on a struggle for ownership and legitimacy.»[25] Effective communication is an inherent element in expertise in the same style as knowledge is. Rather than leaving each other out, substance and communicative style are complementary.[25] Hartelius further suggests that Wikipedia’s dialogic construction of expertise illustrates both the instrumental and the constitutive dimensions of rhetoric; instrumentally as it challenges traditional encyclopedias and constitutively as a function of its knowledge production.[25] Going over the historical development of the encyclopedic project, Hartelius argues that changes in traditional encyclopedias have led to changes in traditional expertise. Wikipedia’s use of hyperlinks to connect one topic to another depends on, and develops, electronic interactivity meaning that Wikipedia’s way of knowing is dialogic.[25] Dialogic expertise then, emerges from multiple interactions between utterances within the discourse community.[25] The ongoing dialogue between contributors on Wikipedia not only results in the emergence of truth; it also explicates the topics one can be an expert of. As Hartelius explains, «the very act of presenting information about topics that are not included in traditional encyclopedias is a construction of new expertise.»[25] While Wikipedia insists that contributors must only publish preexisting knowledge, the dynamics behind dialogic expertise creates new information nonetheless. Knowledge production is created as a function of dialogue.[25] According to Hartelius, dialogic expertise has emerged on Wikipedia not only because of its interactive structure but also because of the site’s hortative discourse which is not found in traditional encyclopedias.[25] By Wikipedia’s hortative discourse, Hartelius means various encouragements to edit certain topics and instructions on how to do so that appear on the site.[25] One further reason to the emergence of dialogic expertise on Wikipedia is the site’s community pages, which function as a techne; explicating Wikipedia’s expert methodology.[25]

Networked expertise[edit]

Building on Hartelius, Damien Pfister developed the concept of «networked expertise». Noting that Wikipedia employs a «many to many» rather than a «one to one» model of communication, he notes how expertise likewise shifts to become a quality of a group rather than an individual. With the information traditionally associated with individual experts now stored within a text produced by a collective, knowing about something is less important than knowing how to find something. As he puts it, «With the internet, the historical power of subject matter expertise is eroded: the archival nature of the Web means that what and how to information is readily available.» The rhetorical authority previously afforded to subject matter expertise, then, is given to those with the procedural knowledge of how to find information called for by a situation.[26]

Contrasts and comparisons[edit]

Associated terms[edit]

An expert differs from the specialist in that a specialist has to be able to solve a problem and an expert has to know its solution. The opposite of an expert is generally known as a layperson, while someone who occupies a middle grade of understanding is generally known as a technician and often employed to assist experts. A person may well be an expert in one field and a layperson in many other fields. The concepts of experts and expertise are debated within the field of epistemology under the general heading of expert knowledge. In contrast, the opposite of a specialist would be a generalist or polymath.

The term is widely used informally, with people being described as ‘experts’ in order to bolster the relative value of their opinion, when no objective criteria for their expertise is available. The term crank is likewise used to disparage opinions. Academic elitism arises when experts become convinced that only their opinion is useful, sometimes on matters beyond their personal expertise.

In contrast to an expert, a novice (known colloquially as a newbie or ‘greenhorn’) is any person that is new to any science or field of study or activity or social cause and who is undergoing training in order to meet normal requirements of being regarded a mature and equal participant.

«Expert» is also being mistakenly interchanged with the term «authority» in new media. An expert can be an authority if through relationships to people and technology, that expert is allowed to control access to his expertise. However, a person who merely wields authority is not by right an expert. In new media, users are being misled by the term «authority». Many sites and search engines such as Google and Technorati use the term «authority» to denote the link value and traffic to a particular topic. However, this authority only measures populist information. It in no way assures that the author of that site or blog is an expert.

An expert is not to be confused with a professional. A professional is someone who gets paid to do something. An amateur is the opposite of a professional, not the opposite of an expert.

Developmental characteristics[edit]

Some characteristics of the development of an expert have been found to include

  • A characterization of this practice as «deliberate practice», which forces the practitioner to come up with new ways to encourage and enable themselves to reach new levels of performance[27]
  • An early phase of learning which is characterized by enjoyment, excitement, and participation without outcome-related goals.[28]
  • The ability to rearrange or construct a higher dimension of creativity. Due to such familiarity or advanced knowledge experts can develop more abstract perspectives of their concepts and/or performances.[27]

Use in literature[edit]

Mark Twain defined an expert as «an ordinary fellow from another town».[29] Will Rogers described an expert as «A man fifty miles from home with a briefcase.» Danish scientist and Nobel laureate Niels Bohr defined an expert as «A person that has made every possible mistake within his or her field.»[30] Malcolm Gladwell describes expertise as a matter of practicing the correct way for a total of around 10,000 hours.

See also[edit]

  • Perceptual learning
  • Consultant – Professional who provides advice in their specific field of expertise
  • Polymath – Individual whose knowledge spans a substantial number of subjects

General[edit]

  • Scholar – Person who pursues academic and intellectual activities
  • Know-how – Ability to do something
  • Skill – Ability to carry out a task
  • Competence – Ability of a person to do a job properly
  • Technocracy – Form of government
  • Tutor expertise in adult education

Criticism[edit]

  • Anti-intellectualism – Hostility to and mistrust of education, philosophy, art, literature, and science
  • Denialism – Person’s choice to deny psychologically uncomfortable truth
  • The Death of Expertise – Book by Tom Nichols
  • Gibson’s law – Every PhD has an equal and opposite PhD

Psychology[edit]

  • Dreyfus model of skill acquisition
  • Dunning–Kruger effect – Cognitive bias about one’s own skill
  • Pygmalion effect – Phenomenon in psychology
  • Rational skepticism – Modern social movement based on the idea of scientific skepticism

References[edit]

  1. ^ a b c Ericsson & Stasewski 1989.
  2. ^ a b Ericsson et al. 2006.
  3. ^ Gobet 2008.
  4. ^ Gobet & Chassy 2008.
  5. ^ Gobet & Campitelli 2007.
  6. ^ Nathan & Petrosino 2003, p. 906.
  7. ^ Borko & Livingston 1989, p. 474.
  8. ^ Borko et al. 1992, p. 195.
  9. ^ Borko & Livingston 1989.
  10. ^ Nathan & Petrosino 2003.
  11. ^ a b Fuller 2005, p. 141.
  12. ^ Simon & Gilmartin 1973.
  13. ^ Gobet & Simon 2000.
  14. ^ Gobet, de Voogt & Retschitzki 2004.
  15. ^ Dreyfus & Dreyfus 2005, p. 788.
  16. ^ Chi, Glasser & Rees 1982.
  17. ^ Sweller, Mawer & Ward 1983.
  18. ^ Chi, Feltovich & Glaser 1981.
  19. ^ a b Chi et al. 1981
  20. ^ a b Germain 2006a.
  21. ^ Swanson & Holton 2009.
  22. ^ Aristotle 2001.
  23. ^ Hartelius 2011.
  24. ^ Hartelius 2010.
  25. ^ a b c d e f g h i j k l m n Hartelius 2010, pp. 505–526.
  26. ^ Pfister 2011.
  27. ^ a b «Definition» Merriam-Webster.
  28. ^ Starkes & Ericsson 2003, p. 91.
  29. ^ Brady, Justin (June 25, 2014). «The troubling flaws in how we select experts». The Washington Post. Retrieved 10 November 2021.
  30. ^ Coughlan 1954.

Bibliography[edit]

  • Aristotle (2001). «Rhetoric». In McKeon, Richard (ed.). The Basic Works of Aristotle. Translated by Roberts, W. Rhys. New York: Modern Library. ISBN 0375757996.
  • Borko, Hilda; Eisenhart, Margaret; Brown, Catherine A.; Underhill, Robert G.; Jones, Doug; Agard, Patricia C. (1992). «Learning to Teach Hard Mathematics: Do Novice Teachers and Their Instructors Give up Too Easily?» (PDF). Journal for Research in Mathematics Education. National Council of Teachers of Mathematics. 23 (3): 194–222. doi:10.5951/jresematheduc.23.3.0194. ISSN 0021-8251.
  • Borko, Hilda; Livingston, Carol (1989). «Cognition and Improvisation: Differences in Mathematics Instruction by Expert and Novice Teachers». American Educational Research Journal. Winter 1989, Vol. 26, No. 4 (4): 473–498. doi:10.3102/00028312026004473. JSTOR 1162861. S2CID 145280199.
  • Chase, W.G.; Simon, Herbert A. (1973a). «The mind’s eye in chess». In W.G. Chase (ed.). Visual information processing. New York: Academic Press. ISBN 978-0-12-170150-5.
  • Chase, W.G.; Simon, Herbert A. (1973b). «Perception in chess». Cognitive Psychology. 4: 55–81. doi:10.1016/0010-0285(73)90004-2.
  • Chi, M. T.; Feltovich, P. J.; Glaser, R. (1981). «Categorization and representation of physics problems by experts and novices». Cognitive Science. 5 (2): 121–152. doi:10.1207/s15516709cog0502_2.
  • Chi, M. T. H.; Glasser, R.; Rees, E. (1982). «Expertise in problem solving». In Sternberg, R. J. (ed.). Advances in the psychology of human intelligence. Vol. 1. Hillsdale, NJ: Erlbaum. pp. 7–75.
  • Collins, R. (1979). The Credential Society
  • Coughlan, Robert (1954-09-06). «Dr. Edward Teller’s Magnificent Obsession». Life Magazine. Quoted by Dr Edward Teller. Retrieved 13 February 2017.
  • «Definition of EXPERT». Merriam Webster Online. Retrieved 2019-10-11.{{cite web}}: CS1 maint: url-status (link)
  • Dewey, J. (1927). The Public and its Problems
  • Dreyfus, H.; Dreyfus, S. (2005). «Expertise in real world contexts» (PDF). Organization Studies. 26 (5): 779–792. CiteSeerX 10.1.1.471.180. doi:10.1177/0170840605053102. S2CID 145718063. Archived from the original (PDF) on 2017-09-22. Retrieved 2017-10-26.
  • Ericsson, K. A. (2000). Expert Performance and Deliberate Practice
  • Ericsson, Anders K.; Charness, Neil; Feltovich, Paul; Hoffman, Robert R. (2006). Cambridge handbook on expertise and expert performance. Cambridge, UK: Cambridge University Press. ISBN 978-0-521-60081-1.
  • Ericsson, Anders K.; Prietula, Michael J.; Cokely, Edward T. (2007). «The Making of an Expert». Harvard Business Review. 85 (July–August 2007): 114–21, 193. PMID 17642130.
  • Ericsson, Anders K.; Stasewski, James J. (1989). «Chapter 9: Skilled Memory and Expertise: Mechanisms of Exceptional Performance». In David Klahr; Kenneth Kotovsky (eds.). Complex Information Processing: The Impact of Herbert A. Simon. Hillesdale N.J.: Lawrence Erlbaum Associates.
  • Fuller, Steve (2005). The Intellectual. Icon Books. p. 141. ISBN 9781840467215.
  • Germain, M.-L. (2005). Apperception and self-identification of managerial and subordinate expertise. Academy of Human Resource Development. Estes Park, CO. February 24–27.
  • Germain, M.-L. (2006a), Development and preliminary validation of a psychometric measure of expertise: The Generalized Expertise Measure (GEM) (Unpublished Doctoral Dissertation), Barry University, Florida
  • Germain, M.-L. (2006b). Perception of Instructors’ Expertise by College Students: An Exploratory Qualitative Research Study. American Educational Research Association annual conference, San Francisco, CA. April 7–11.
  • Germain, M.-L. (2006c). What experts are not: Factors identified by managers as disqualifiers for selecting subordinates for expert team membership. Academy of Human Resource Development Conference. Columbus, OH. February 22–26.
  • Germain, M.-L. (2009). The impact of perceived administrators’ expertise on subordinates’ job satisfaction and turnover intention. Academy of Human Resource Development. Arlington, VA. February 18–22.
  • Germain, M.-L., & Tejeda, M. J. (2012). A preliminary exploration on the measurement of expertise: An initial development of a psychometric scale. Human Resource Development Quarterly, 23, no. 2, 203–232. doi:10.1002/hrdq.21134.
  • Gibbons, M. (1994). Visual information processing. London: SAGE Publications. ISBN 978-0-8039-7794-5.
  • Gobet, Fernand (2008). «The role of deliberate practice in expertise: Necessary but not sufficient». bura.brunel.ac.uk. Retrieved June 16, 2010.{{cite web}}: CS1 maint: url-status (link)
  • Gobet, F.; Campitelli, G. (2007). «The role of domain-specific practice, handedness and starting age in chess» (PDF). Developmental Psychology. 43 (1): 159–172. doi:10.1037/0012-1649.43.1.159. PMID 17201516.
  • Gobet, F.; Chassy, P. (2008). «Season of birth and chess expertise» (PDF). Journal of Biosocial Science. 40 (2): 313–316. doi:10.1017/S0021932007002222. PMID 18335581. S2CID 10033606. Archived from the original (PDF) on 2011-07-18. Retrieved 2011-07-03.
  • Gobet, F. (2015). Understanding expertise: A multi-disciplinary approach. London, UK: Palgrave/Macmilland. ISBN 9780230276246.
  • Gobet, F.; de Voogt, A. J.; Retschitzki, J. (2004). Moves in mind: The psychology of board games. Hove, UK: Psychology Press. ISBN 978-1-84169-336-1.
  • Gobet, F.; Simon, Herbert A. (2000). «Five seconds or sixty? Presentation time in expert memory» (PDF). Cognitive Science. 24 (4): 651–682. doi:10.1207/s15516709cog2404_4. S2CID 10577260.
  • Goldman, A. I. (1999). Knowledge in a Social World[dead link]. Oxford: Oxford University Press.
  • Hartelius, E. Johanna (2010-11-09). «Wikipedia and the Emergence of Dialogic Expertise». Southern Communication Journal. Informa UK Limited. 75 (5): 505–526. doi:10.1080/10417940903377169. ISSN 1041-794X. S2CID 144862927.
  • Hartelius, E. Johanna (2011), The Rhetoric of Expertise, Lanham: Lexington
  • Kitsikis, Dimitri, Le rôle des experts à la Conférence de la Paix. Gestation d’une technocratie en politique internationale. Ottawa, Editions de l’Université d’Ottawa, 1972, 227 pages.
  • Mieg, Harald A. (2001). The social psychology of expertise. Mahwah, NJ: Lawrence Erlbaum Associates.
  • Nathan, M.J.; Petrosino, A. (2003). «Expert Blind Spot Among Preservice Teachers» (PDF). American Educational Research Journal. Winter 2003, Vol. 40 (4): 905–928. doi:10.3102/00028312040004905. S2CID 145129059. Archived from the original (PDF) on 2015-04-24.
  • Nettleton, S.; Burrows, R.; O’Malley, L. (2005). «The mundane realities of the everyday use of the internet for health, and their consequences for media convergence». Sociology of Health and Illness. 27 (7): 972–992. doi:10.1111/j.1467-9566.2005.00466.x. PMID 16313525.
  • Pfister, Damien Smith (2011). «Networked Expertise in the Era of Many-to-many Communication: On Wikipedia and Invention». Social Epistemology. Informa UK Limited. 25 (3): 217–231. doi:10.1080/02691728.2011.578306. ISSN 0269-1728. S2CID 17067499.
  • Shanteau, J.; Weiss, D.J.; Thomas, R.P.; Pounds, J.C. (2002). «Performance-based assessment of expertise: How to decide if someone is an expert or not». European Journal of Operational Research. 136 (2): 253–263. doi:10.1016/S0377-2217(01)00113-8.
  • Simon, H. A.; Chase, W.G. (1973). «Skill in chess». American Scientist. 61 (4): 394–403. Bibcode:1973AmSci..61..394S.
  • Simon, H. A.; Gilmartin, K. J. (1973). «A simulation of memory for chess positions». Cognitive Psychology. 5: 29–46. doi:10.1016/0010-0285(73)90024-8.
  • Sowell, T. (1980). Knowledge and decisions. New York: Basic Books, Inc.
  • Starkes, J.L.; Ericsson, K.A. (2003). Expert Performance in Sports: Advances in Research on Sport Expertise. Human Kinetics. ISBN 978-0-7360-4152-2. Retrieved 2022-06-15.
  • Swanson, Richard A.; Holton, Elwood F., III (2009). Foundations of human resource development (PDF). San Francisco: Berrett-Kohler Publishers. ISBN 978-1-57675-803-8. OCLC 489195461.
  • Sweller, J.; Mawer, R. F.; Ward, M. R. (1983). «Development of expertise in mathematical problem solving». Journal of Experimental Psychology. 112 (4): 639–661. doi:10.1037/0096-3445.112.4.639.
  • Tynjälä, Päivi (1999). «Towards expert knowledge? A comparison between a constructivist and a traditional learning environment in the university». International Journal of Educational Research. 31 (5): 357–442. CiteSeerX 10.1.1.58.2038. doi:10.1016/S0883-0355(99)00012-9. S2CID 18750105.

Further reading[edit]

Look up expert in Wiktionary, the free dictionary.

Look up expertise in Wiktionary, the free dictionary.

Wikiquote has quotations related to Expert.

Books and publications
  • Brint, Steven. 1994. In an Age of Experts: The Changing Roles of Professionals in Politics and Public Life. Princeton University Press.
  • Ikujiro Nonaka, Georg von Krogh, and Sven Voelpel, Organizational Knowledge Creation Theory: Evolutionary Paths and Future Advances. Organization Studies, Vol. 27, No. 8, 1179-1208 (2006). SAGE Publications, 2006. DOI 10.1177/0170840606066312
  • Sjöberg, Lennart (2001). «Limits of Knowledge and the Limited Importance of Trust» (PDF). Risk Analysis. 21 (1): 189–198. CiteSeerX 10.1.1.321.4451. doi:10.1111/0272-4332.211101. PMID 11332547. S2CID 17549251. Archived from the original (PDF) on 2017-08-08. Retrieved 2017-10-24.
  • Hofer, Barbara K.; Pintrich, Paul R. (1997). «The Development of Epistemological Theories: Beliefs about Knowledge and Knowing and Their Relation to Learning». Review of Educational Research. 67 (1): 88–140. doi:10.2307/1170620. JSTOR 1170620.
  • B Wynne, May the sheep safely graze? A reflexive view of the expert-lay knowledge divide. Risk, Environment and Modernity: Towards a New Ecology, 1996.
  • Thomas H. Davenport, et al., Working knowledge . 1998, knowledge.hut.fi.
  • Mats Alvesson, Knowledge work: Ambiguity, image and identity. Human Relations, Vol. 54, No. 7, 863-886 (2001). The Tavistock Institute, 2001.
  • Peter J. Laugharne, Parliament and Specialist Advice, Manutius Press, 1994.
  • Jay Liebowitz, Knowledge Management Handbook. CRC Press, 1999. 328 pages. ISBN 0-8493-0238-2
  • C. Nadine Wathen and Jacquelyn Burkell, Believe it or not: Factors influencing credibility on the Web. Journal of the American Society for Information Science and Technology, VL. 53, NO. 2. PG 134–144. John Wiley & Sons, Inc., 2002. DOI 10.1002/asi.10016
  • Nico Stehr, Knowledge Societies. Sage Publications, 1994. 304 pages. ISBN 0-8039-7892-8
Patents
  • U.S. Patent 4,803,641, Basic expert system tool, Steven Hardy et al., Filed November 25, 1987, Issued February 7, 1989.

  • Top Definitions
  • Synonyms
  • Quiz
  • Related Content
  • Examples
  • British

This shows grade level based on the word’s complexity.

[ noun, verb ek-spurt; adjective ek-spurt, ik-spurt ]

/ noun, verb ˈɛk spɜrt; adjective ˈɛk spɜrt, ɪkˈspɜrt /

This shows grade level based on the word’s complexity.


noun

a person who has special skill or knowledge in some particular field; specialist; authority: a language expert.

Military.

  1. the highest rating in rifle marksmanship, above that of marksman and sharpshooter.
  2. a person who has achieved such a rating.

adjective

possessing special skill or knowledge; trained by practice; skillful or skilled (often followed by in or at): an expert driver; to be expert at driving a car.

pertaining to, coming from, or characteristic of an expert: expert work; expert advice.

verb (used with object)

QUIZ

CAN YOU ANSWER THESE COMMON GRAMMAR DEBATES?

There are grammar debates that never die; and the ones highlighted in the questions in this quiz are sure to rile everyone up once again. Do you know how to answer the questions that cause some of the greatest grammar debates?

Which sentence is correct?

Origin of expert

1325–75; Middle English (adj.) <Latin expertus, past participle of experīrī to try, experience

synonym study for expert

OTHER WORDS FROM expert

ex·pert·ly, adverbex·pert·ness, nounnon·ex·pert, noun, adjectivepro·ex·pert, adjective

un·ex·pert, adjective

Words nearby expert

experimental psychology, experimental theater, experimentation, experimenter effect, experiment station, expert, expertise, expertism, expertize, expert system, expert witness

Dictionary.com Unabridged
Based on the Random House Unabridged Dictionary, © Random House, Inc. 2023

Words related to expert

adept, adroit, deft, experienced, skilled, skillful, trained, artist, authority, professional, crack, crackerjack, handy, savvy, sharp, slick, virtuoso, ace, artiste, buff

How to use expert in a sentence

  • Postal workers and independent experts say that has caused mail to pile up in post offices and caused multiday delays in localities across the country.

  • She added that she felt Pence’s top officials often showed derision toward the administration’s medical experts.

  • His suspicions are out of step with the views of election experts and many within his own party, who are building large-scale vote-by-mail programs.

  • Unless we have a dermatologist, a doctor, an expert co-sign that product, we don’t cover it.

  • States have broad power — known as “police power” — to protect public health in an emergency, even when doing so infringes on individual liberties, legal experts say.

  • I went into the audition as Fericito, the Venezuelan percussionist, and then I did a self-defense expert.

  • “He was a brave field commander and an expert in intelligence, and in organizing popular and tribal forces,” said the eulogist.

  • Well, one expert I talked to said that physically it involves little more than a $20 cable.

  • An expert in education talks about race relations, the political environment and what can be done to improve things.

  • Carter has also been a fixture on boards and expert panels, in think tanks and at universities.

  • And having an enormous appetite he was fortunate in being expert at finding angleworms.

  • He has his particular likings and tit-bits, and is very expert in carving out the parts of an animal that please him best.

  • But, as many people know, and all may believe, running in a crowded London street is difficult—even to an expert London thief.

  • When conversing recently with an expert on this subject I asked whether the use of asbestos would not effect the desired object.

  • His services as witness and expert adviser were in great request by railway companies.

British Dictionary definitions for expert


noun

a person who has extensive skill or knowledge in a particular field

adjective

skilful or knowledgeable

of, involving, or done by an expertan expert job

Derived forms of expert

expertly, adverbexpertness, noun

Word Origin for expert

C14: from Latin expertus known by experience, from experīrī to test; see experience

Collins English Dictionary — Complete & Unabridged 2012 Digital Edition
© William Collins Sons & Co. Ltd. 1979, 1986 © HarperCollins
Publishers 1998, 2000, 2003, 2005, 2006, 2007, 2009, 2012

ex·pert

 (ĕk′spûrt′)

n.

A person with a high degree of skill in or knowledge of a certain subject.

adj. (ĕk′spûrt, ĭk-spûrt′)

Having, involving, or demonstrating skill in or knowledge of a certain subject. See Synonyms at proficient.


[Middle English, from Old French, experienced, from Latin expertus, past participle of experīrī, to try; see per- in Indo-European roots.]


ex′pert′ly adv.

ex′pert′ness n.

American Heritage® Dictionary of the English Language, Fifth Edition. Copyright © 2016 by Houghton Mifflin Harcourt Publishing Company. Published by Houghton Mifflin Harcourt Publishing Company. All rights reserved.

expert

(ˈɛkspɜːt)

n

a person who has extensive skill or knowledge in a particular field

adj

1. skilful or knowledgeable

2. of, involving, or done by an expert: an expert job.

[C14: from Latin expertus known by experience, from experīrī to test; see experience]

ˈexpertly adv

ˈexpertness n

Collins English Dictionary – Complete and Unabridged, 12th Edition 2014 © HarperCollins Publishers 1991, 1994, 1998, 2000, 2003, 2006, 2007, 2009, 2011, 2014

ex•pert

(ˈɛk spɜrt; adj. also ɪkˈspɜrt)

n.

1. a person who has special skill or knowledge in a particular field.

adj.

2. possessing special skill or knowledge.

3. pertaining to or characteristic of an expert: expert advice.

[1325–75; Middle English < Latin expertus, past participle of experīrī to try, test]

ex•pert′ly, adv.

ex•pert′ness, n.

Random House Kernerman Webster’s College Dictionary, © 2010 K Dictionaries Ltd. Copyright 2005, 1997, 1991 by Random House, Inc. All rights reserved.

experience, experiment, expert — Experience, experiment and expert derive from Latin experiri, «try.»

See also related terms for try.

Farlex Trivia Dictionary. © 2012 Farlex, Inc. All rights reserved.

ThesaurusAntonymsRelated WordsSynonymsLegend:

Noun 1. expert - a person with special knowledge or ability who performs skillfullyexpert — a person with special knowledge or ability who performs skillfully

adept, hotshot, maven, mavin, superstar, virtuoso, whiz, whizz, wiz, wizard, sensation, star, ace, genius, champion — someone who is dazzlingly skilled in any field

agronomist — an expert in soil management and field-crop production

all arounder, all-rounder — a versatile person who is expert at many things; «she’s the best all-rounder they’ve seen in years»

analyst — someone who is skilled at analyzing data

analyst — an expert who studies financial data (on credit or securities or sales or financial patterns etc.) and recommends appropriate business actions

arbiter, supreme authority — someone with the power to settle matters at will; «she was the final arbiter on all matters of fashion»

archer, bowman — a person who is expert in the use of a bow and arrow

authority — an expert whose views are taken as definitive; «he is an authority on corporate law»

black belt — a person who attained the rank of expert in the martial arts (judo or karate)

kabbalist, cabalist — an expert who is highly skilled in obscure or difficult or esoteric matters

exegete — a person skilled in exegesis (especially of religious texts)

horticulturist, plantsman — an expert in the science of cultivating plants (fruit or flowers or vegetables or ornamental plants)

jurist, legal expert — a legal scholar versed in civil law or the law of nations

lapidarist, lapidary — an expert on precious stones and the art of cutting and engraving them

mnemonist — an expert in the use of mnemonics; someone able to perform unusual feats of memory

nerd — an intelligent but single-minded expert in a particular technical field or profession

out-and-outer — someone who is excellent at something

parliamentarian — an expert in parliamentary rules and procedures

past master — someone who has long and thorough experience in a given activity

pathfinder, scout, guide — someone who can find paths through unexplored territory

shark — a person who is unusually skilled in certain ways; «a card shark»

shooter, shot — a person who shoots (usually with respect to their ability to shoot); «he is a crack shot»; «a poor shooter»

talent — a person who possesses unusual innate ability in some field or activity

technician — someone known for high skill in some intellectual or artistic technique

technocrat — an expert who is a member of a highly skilled elite group

healer, therapist — a person skilled in a particular type of therapy

Adj. 1. expert - having or showing knowledge and skill and aptitudeexpert — having or showing knowledge and skill and aptitude; «adept in handicrafts»; «an adept juggler»; «an expert job»; «a good mechanic»; «a practiced marksman»; «a proficient engineer»; «a lesser-known but no less skillful composer»; «the effect was achieved by skillful retouching»

skilled — having or showing or requiring special skill; «only the most skilled gymnasts make an Olympic team»; «a skilled surgeon has many years of training and experience»; «a skilled reconstruction of her damaged elbow»; «a skilled trade»

2. expert — of or relating to or requiring special knowledge to be understood; «technical terminology»; «a technical report»; «technical language»

skilled — having or showing or requiring special skill; «only the most skilled gymnasts make an Olympic team»; «a skilled surgeon has many years of training and experience»; «a skilled reconstruction of her damaged elbow»; «a skilled trade»

Based on WordNet 3.0, Farlex clipart collection. © 2003-2012 Princeton University, Farlex Inc.

expert

noun

1. specialist, authority, professional, master, pro (informal), ace (informal), genius, guru, pundit, buff (informal), wizard, adept, whizz (informal), maestro, virtuoso, connoisseur, boffin (Brit. informal), hotshot (informal), rocket scientist (informal, chiefly U.S.), past master, dab hand (Brit. informal), wonk (informal), maven (U.S.), fundi (S. African) an expert in computer graphics
specialist amateur, novice, layman, dabbler, nonprofessional, ham

adjective

1. skilful, trained, experienced, able, professional, skilled, master, masterly, qualified, talented, outstanding, clever, practised, accomplished, handy, competent, tasty (Brit. informal), apt, adept, knowledgeable, virtuoso, deft, proficient, facile, adroit, dexterous The faces of the waxworks are modelled by expert sculptors.
skilful inexperienced, incompetent, clumsy, unskilled, unqualified, untrained, amateurish, cack-handed (informal), unpractised

Quotations
«An expert is a man who has made all the mistakes which can be made in a very narrow field» [Niels Henrik David Bohr]
«An expert is one who knows more and more about less and less» [Nicholas Murray Butler]
«An expert is someone who knows some of the worst mistakes that can be made in his subject and who manages to avoid them» [Werner Heisenberg Der Teil und das Ganze]

Collins Thesaurus of the English Language – Complete and Unabridged 2nd Edition. 2002 © HarperCollins Publishers 1995, 2002

expert

noun

A person with a high degree of knowledge or skill in a particular field:

Chiefly British: dab.

adjective

Having or demonstrating a high degree of knowledge or skill:

The American Heritage® Roget’s Thesaurus. Copyright © 2013, 2014 by Houghton Mifflin Harcourt Publishing Company. Published by Houghton Mifflin Harcourt Publishing Company. All rights reserved.

Translations

odborníkodbornýzkušenýznalecexpert

ekspertekspert-fagmandsagkyndig

asjatundjaekspert

asiantuntijaeksperttitaitavaasiantunteva

stručnjakznalacekspert

szakavatott

reyndur; mjög fær, snjallsérfræîingur

専門家専門的な熟練者

전문가

įgudimasprityręssu įgudimu

eksperta-, lietpratēja-eksperts, lietpratējslietpratīgsspeciālists

strokovnjak

expertexpert-sakkunnig

ผู้เชี่ยวชาญ

chuyên gia

Collins Spanish Dictionary — Complete and Unabridged 8th Edition 2005 © William Collins Sons & Co. Ltd. 1971, 1988 © HarperCollins Publishers 1992, 1993, 1996, 1997, 2000, 2003, 2005

expert

[ˈɛkspɜːrt]

adj

[person] → expert(e)
He’s an expert cook
BUT Il cuisine très bien.
to be expert at doing sth → être spécialiste de qch

[opinion, help] → d’un expert expert witness

Collins English/French Electronic Resource. © HarperCollins Publishers 2005

expert

nExperte m, → Expertin f; (= professional)Fachmann m, → Fachfrau f; (Jur) → Sachverständige(r) mf; he is an expert on the subject/at that sort of negotiationer ist Fachmann or Experte auf diesem Gebiet/für solche Verhandlungen; expert in geologyFachmann m/Fachfrau ffür Geologie, Geologieexperte m/-expertin f; an expert at chessein Schachexperte m, → eine Schachexpertin; she is an expert on wines/oriental philosophysie ist eine Weinexpertin/eine Expertin auf dem Gebiet der orientalischen Philosophie; with the eye of an expertmit fachmännischem Blick; to get the advice of expertsExperten/Sachverständige zurate or zu Rate ziehen; expert’s reportSachverständigenbericht m, → Gutachten nt; OK, you do it, you’re the expertgut, machen Sies, Sie sind der Fachmann; he’s an expert at saying the wrong thing (iro)er versteht es meisterhaft, genau das Falsche zu sagen

Collins German Dictionary – Complete and Unabridged 7th Edition 2005. © William Collins Sons & Co. Ltd. 1980 © HarperCollins Publishers 1991, 1997, 1999, 2004, 2005, 2007

expert

[ˈɛkspɜːt]

1. adj (gen) → esperto/a; (advice, help) → da esperto
expert in or at doing sth → esperto/a nel fare qc

2. nesperto/a
an expert on sth/in or at doing sth → un(a) esperto/a di qc/nel fare qc

Collins Italian Dictionary 1st Edition © HarperCollins Publishers 1995

expert

(ˈekspəːt) adjective

(with at or on) skilled through training or practice. an expert car designer; I’m expert at map-reading; Get expert advice on plumbing.

noun

a person who is an expert. an expert in political history / on ancient pottery.

ˈexpertly adverbˈexpertness noun

Kernerman English Multilingual Dictionary © 2006-2013 K Dictionaries Ltd.

expert

خَبِير odborník ekspert Experte ειδικός experto asiantuntija expert stručnjak esperto 専門家 전문가 expert ekspert fachowiec perito эксперт expert ผู้เชี่ยวชาญ uzman chuyên gia 专家

Multilingual Translator © HarperCollins Publishers 2009

expert

a. experto-a, perito-a.

English-Spanish Medical Dictionary © Farlex 2012

expert

adj & n experto -ta mf, especialista mf; — opinion opinión f de expertos

English-Spanish/Spanish-English Medical Dictionary Copyright © 2006 by The McGraw-Hill Companies, Inc. All rights reserved.

English[edit]

Etymology[edit]

From Old French, from Latin expertus.

Pronunciation[edit]

  • (General American) IPA(key): /ˈɛkspɚt/
  • (Received Pronunciation) IPA(key): /ˈɛkspəːt/

Adjective[edit]

expert (comparative more expert, superlative most expert)

  1. Extraordinarily capable or knowledgeable.

    I am expert at making a simple situation complex.

    My cousin is an expert pianist.

  2. Characteristic of an expert.

    This problem requires expert knowledge.

  3. (obsolete) Proven, experienced, veteran.

Synonyms[edit]

  • See also Thesaurus:skillful

Antonyms[edit]

  • inexpert
  • nonexpert

Derived terms[edit]

  • expert system
  • expert witness

Translations[edit]

characteristic of an expert

  • Bulgarian: експертен (eksperten)
  • Chinese:
    Mandarin: please add this translation if you can
  • Czech: odborný (cs) m
  • Finnish: asiantunteva
  • Greek: ειδικός (el) m (eidikós)
  • Hungarian: szakavatott
  • Italian: specialistico (it)
  • Japanese: 専門的 (ja) (せんもんてき, senmonteki)
  • Korean: 전문적 (ko) (jeonmunjeok)
  • Scottish Gaelic: ealanta, teòma
  • Spanish: pericial
  • Swedish: expert- (sv) c
  • Turkish: ustaca (tr), usta (tr)

Noun[edit]

expert (plural experts)

  1. A person with extensive knowledge or ability in a given subject.
    • If an expert says it can’t be done, get another expert. — David Ben-Gurion

    • 2013 July 20, “Welcome to the plastisphere”, in The Economist, volume 408, number 8845:

      Plastics are energy-rich substances, which is why many of them burn so readily. Any organism that could unlock and use that energy would do well in the Anthropocene. Terrestrial bacteria and fungi which can manage this trick are already familiar to experts in the field.

    We called in several experts on the subject, but they couldn’t reach an agreement.

  2. (chess) A player ranking just below master.

Synonyms[edit]

  • maven
  • specialist

Hyponyms[edit]

  • connoisseur

Coordinate terms[edit]

  • initiate (anyone initiated, anywhere from basic familiarity to expertise)

Translations[edit]

person with extensive knowledge or ability

  • Albanian: ekspert (sq) m
  • Amharic: ዓዋቂ (ʿawaḳi)
  • Arabic: مُتَخَصِّص‎ m (mutaḵaṣṣiṣ), مُتَخَصِّصَة‎ f (mutaḵaṣṣiṣa), خَبِير‎ m (ḵabīr), خَبِيرَة‎ f (ḵabīra)
    Egyptian Arabic: خبير‎ m (ḵabīr)
  • Armenian: փորձագետ (hy) (pʿorjaget)
  • Azerbaijani: ekspert, mütəxəssis
  • Bashkir: белгес (belges)
  • Basque: aditu
  • Belarusian: экспе́рт m (ekspjért), экспэ́рт m (ekspért)
  • Bengali: বিশেষজ্ঞ (bn) (biśeśoggo), দক্ষ (bn) (dôkkhô)
  • Bulgarian: експе́рт (bg) m (ekspért)
  • Burmese: ကျွမ်းကျင်သူ (kywam:kyangsu)
  • Catalan: expert (ca) m
  • Chinese:
    Cantonese: 專家专家 (zyun1 gaa1), 高手 (gou1 sau2)
    Hakka: 高手 (kô-sú)
    Mandarin: 專家专家 (zh) (zhuānjiā), 專門家专门家 (zh) (zhuānménjiā), 高手 (zh) (gāoshǒu)
    Min Nan: 高手 (zh-min-nan) (ko͘-chhiú)
  • Czech: odborník (cs) m, expert (cs) m, znalec (cs) m
  • Danish: ekspert (da) c
  • Dutch: deskundige (nl), expert (nl)
  • Esperanto: kompetentulo
  • Estonian: asjatundja, ekspert (et)
  • Finnish: asiantuntija (fi), ekspertti (fi)
  • French: expert (fr) m
  • Galician: experto (gl) m
  • Georgian: ექსპერტი (eksṗerṭi), სპეციალისტი (sṗecialisṭi), მცოდნე (mcodne)
  • German: Experte (de) m, Fachmann (de) m, Fachfrau (de) f
  • Greek: εμπειρογνώμων (el) (empeirognómon), εμπειροτέχνης (el) m (empeirotéchnis), δεξιοτέχνης (el) m or f (dexiotéchnis)
    Ancient: ἐπιστήμων m (epistḗmōn)
  • Hebrew: מומחה / מֻמְחֶה (he) m (mumkhé)
  • Hindi: विशेषज्ञ (hi) m (viśeṣagya), माहिर (hi) m (māhir), कबीर (hi) m (kabīr), सिद्धहस्त (hi) m (siddhahast)
  • Hungarian: szakértő (hu), szakember (hu)
  • Icelandic: sérfræðingur m
  • Indonesian: ahli (id), pakar (id), eksper (id), spesialis (id)
  • Irish: saineolaí m
  • Italian: esperto (it) m
  • Japanese: 専門家 (ja) (senmonka), 熟練者 (jukurensha), 名人 (ja) (meijin)
  • Javanese: juru (jv)
  • Kazakh: сарапшы (kk) (sarapşy), маман (maman)
  • Khmer: ជំនាញ (km) (cumniəñ), អ្នកឯកទេស (nĕək ʼaekteih)
  • Korean: 숙련자(熟鍊者) (sungnyeonja), 전문가(專門家) (ko) (jeonmun’ga), 명인(名人) (ko) (myeong’in)
  • Kurdish:
    Northern Kurdish: pispor (ku)
  • Kyrgyz: билгич (ky) (bilgiç)
  • Lao: ຜູ້ຊ່ຽວຊານ (phū siāu sān)
  • Latin: consultus m
  • Latvian: eksperts m, eksperte f
  • Lithuanian: ekspertas m
  • Macedonian: експерт m (ekspert)
  • Malay: pakar (ms)
  • Maori: tautōhito, pūkenga, mātanga
  • Mongolian:
    Cyrillic: мэргэжилтэн (mn) (mergežilten), шинжээч (mn) (šinžeeč), эксперт (ekspert)
  • Navajo: yééhósinígíí
  • Ngazidja Comorian: mtââlamu class 1/2
  • Norwegian:
    Bokmål: ekspert m
  • Occitan: expèrt (oc) m
  • Ottoman Turkish: متخصص(mütehassıs)
  • Pashto: ماهر‎ m (māher), متخصص‎ m (motaxases)
  • Persian: خبره (fa) (xebre), متخصص (fa) (motexasses)
  • Polish: ekspert (pl) m
  • Portuguese: expert (pt) m or f, especialista (pt) m or f, perito (pt) m
  • Romanian: expert (ro) m
  • Russian: экспе́рт (ru) m (ekspért), специали́ст (ru) m (specialíst), специали́стка (ru) f (specialístka), знато́к (ru) m (znatók)
  • Scottish Gaelic: ealantach m, eòlaiche m
  • Serbo-Croatian:
    Cyrillic: ѐксперт m, стру̏чња̄к m, зна́лац m
    Roman: èkspert (sh) m, strȕčnjāk (sh) m, ználac (sh) m
  • Slovak: odborník (sk) m, znalec m, expert (sk) m
  • Slovene: strokovnjak m, izvedenec m
  • Sorbian:
    Lower Sorbian: eksperta m
  • Spanish: perito (es) m, experto (es) m, conocedor (es)
  • Swahili: mtaalam (sw), mtaalamu (sw)
  • Swedish: expert (sv) c, sakkunnig (sv) c
  • Tagalog: dalubhasa, eksperto
  • Tajik: мутахассис (tg) (mutaxassis), эксперт (tg) (ekspert)
  • Tatar: белгеч (tt) (belgeç)
  • Thai: ผู้เชี่ยวชาญ (th) (pûu-chîao-chaan)
  • Tibetan: please add this translation if you can
  • Turkish: uzman (tr), usta (tr), üstat (tr), mütehassıs (tr), bilirkişi (tr)
  • Turkmen: ekspert, ussat
  • Ukrainian: експе́рт (uk) m (ekspért), фахіве́ць (uk) m (faxivécʹ), знаве́ць m (znavétsʹ)
  • Urdu: ماہر(māhir)
  • Uyghur: مۇتەخەسسىس(mutexessis)
  • Uzbek: ekspert (uz), mutaxassis (uz)
  • Vietnamese: chuyên gia (vi)
  • Welsh: arbenigwr (cy) m
  • Yiddish: עקספּערט‎ m (ekspert)
  • Zazaki: pıspor m, pıspore f

chess ranking

  • Chinese:
    Mandarin: please add this translation if you can
  • Finnish: ekspertti (fi)
  • Galician: experto (gl) m

Further reading[edit]

  • «expert» in Raymond Williams, Keywords (revised), 1983, Fontana Press, page 129.

Anagrams[edit]

  • pretex, xerept

Catalan[edit]

Adjective[edit]

expert (feminine experta, masculine plural experts, feminine plural expertes)

  1. expert

Noun[edit]

expert m (plural experts, feminine experta)

  1. expert
    Synonym: perit

Further reading[edit]

  • “expert” in Diccionari de la llengua catalana, segona edició, Institut d’Estudis Catalans.

Czech[edit]

Pronunciation[edit]

  • IPA(key): [ˈɛkspɛrt]

Noun[edit]

expert m anim

  1. expert (person with extensive knowledge or ability in a given subject)
    Synonyms: odborník, znalec

[edit]

  • expertní

Further reading[edit]

  • expert in Příruční slovník jazyka českého, 1935–1957
  • expert in Slovník spisovného jazyka českého, 1960–1971, 1989

Dutch[edit]

Etymology[edit]

From Middle Dutch expert, from Middle French expert, from Old French expert, from Latin expertus.

Pronunciation[edit]

  • IPA(key): (chiefly Netherlands) /ɛksˈpɛːr/, (chiefly Belgium) /ɛksˈpɛrt/
  • Hyphenation: ex‧pert
  • Rhymes: -ɛːr, -ɛrt

Noun[edit]

expert m (plural experts or experten, diminutive expertje n)

  1. expert

Usage notes[edit]

When expert is pronounced with a silent t (common in Netherlandic Dutch), the plural is experts. When the t is pronounced (common in Belgian Dutch), the plural is experten.

Synonyms[edit]

  • deskundige

[edit]

  • expertise

Descendants[edit]

  • Afrikaans: ekspert
  • Indonesian: eksper
  • West Frisian: ekspert

French[edit]

Etymology[edit]

From Latin expertus.

Pronunciation[edit]

  • IPA(key): /ɛk.spɛʁ/

Adjective[edit]

expert (feminine experte, masculine plural experts, feminine plural expertes)

  1. expert
    Il est expert en matière de finances(please add an English translation of this usage example)
    Il est expert dans les sciences humaines et sociales.(please add an English translation of this usage example)

Derived terms[edit]

  • expertement
  • expertise

[edit]

  • inexpert

Noun[edit]

expert m (plural experts, feminine experte)

  1. expert

Descendants[edit]

  • Turkish: eksper

Further reading[edit]

  • “expert”, in Trésor de la langue française informatisé [Digitized Treasury of the French Language], 2012.

German[edit]

Etymology[edit]

Borrowed from French expert.

Pronunciation[edit]

  • IPA(key): [ɛksˈpɛʁt]
  • Hyphenation: ex‧pert

Adjective[edit]

expert (strong nominative masculine singular experter, not comparable)

  1. expert

Declension[edit]

Positive forms of expert (uncomparable)

Further reading[edit]

  • “expert” in Duden online
  • “expert” in Digitales Wörterbuch der deutschen Sprache

Portuguese[edit]

Etymology[edit]

Unadapted borrowing from English expert. Doublet of esperto and experto.

Pronunciation[edit]

  • Audio (Center-West, Brazil) (file)
  • (Brazil) IPA(key): /ˈɛks.pɛʁt͡ʃ/

Noun[edit]

expert m or f by sense (plural experts)

  1. expert (person with extensive knowledge or ability in a given field)
    Synonyms: especialista, perito, experto

[edit]

  • expertise

Romanian[edit]

Etymology[edit]

Borrowed from French expert, from Latin expertus.

Noun[edit]

expert m (plural experți, feminine equivalent expertă)

  1. expert (person with extensive knowledge or ability in a given field)
  2. (computing) wizard (program or script used to simplify complex operations)

Declension[edit]

Synonyms[edit]

  • (expert): specialist
  • (wizard): asistent

Swedish[edit]

Pronunciation[edit]

Noun[edit]

expert c

  1. expert

Declension[edit]

Declension of expert 
Singular Plural
Indefinite Definite Indefinite Definite
Nominative expert experten experter experterna
Genitive experts expertens experters experternas

Derived terms[edit]

  • dataexpert
  • expertbedömning
  • expertgranskning
  • expertgrupp
  • experthjälp
  • expertjury
  • expertkommentar
  • expertkommentator
  • expertkommitté
  • expertkunskap
  • expertpanel
  • expertråd
  • experttips
  • expertutlåtande
  • expertutredning
  • expertuttalande
  • expertvittne
  • expertvälde

[edit]

  • expertis

See also[edit]

  • kännare
  • sakkunnig

References[edit]

  • expert in Svenska Akademiens ordlista (SAOL)

Meaning expert

What does expert mean? Here you find 22 meanings of the word expert. You can also add a definition of expert yourself

1

0

 
0

An individual who has special training, skill, experiences, or knowledge so as to be qualified to render an authoritative opinion in a particular area of scientific, technical, or professional exper [..]

2

0

 
0

expert

late 14c., «having had experience; skillful,» from Old French expert, espert «experienced, practiced, skilled» and directly from Latin expertus (contracted from *experitus), » [..]

3

0

 
0

expert

early 15c., «person wise through experience,» from expert (adj.). The word reappeared 1825 in the legal sense, «person who, by virtue of special acquired knowledge or experience on a su [..]

4

0

 
0

expert

One who is skilled by virtue of learning and experience. One who has acquired special knowledge, skill or mastery of something. [D02749]

5

0

 
0

expert

a person with special knowledge or ability who performs skillfully adept: having or showing knowledge and skill and aptitude; &amp;quot;adept in handicrafts&amp;quot;; &amp;quot;an adept j [..]

6

0

 
0

expert

someone who knows a lot about a particular subject

7

0

 
0

expert

Could refer to a dealer expert, the company expert or the Expert Series instructor.

8

0

 
0

expert

mumkhe

9

0

 
0

expert

a person with special or superior skill or knowledge in a particular area see also expert witness at witness

10

0

 
0

expert

&quot;Ex&quot; is the Latin word for something that is apart from the main body and &quot;spurt&quot; is a drip under pressure. An expert is a drip under pressure and out of the mainst [..]

11

0

 
0

expert

A person engaged by a contractor to provide the expertise required for the proper performance of a contract.

12

0

 
0

expert

(n) a person with special knowledge or ability who performs skillfully(adj) having or showing knowledge and skill and aptitude(adj) of or relating to or requiring special knowledge to be understood

13

0

 
0

expert

peritus, gnarus, professor

14

0

 
0

expert

person with a high degree of skill in or knowledge of a certain subject; having, involving, or demonstrating great skills, dexterity, or knowledge as the result of experience or training.

15

0

 
0

expert

   Staffer

16

0

 
0

expert

A term from JCP 2.9 and earlier that referred to a Member representative who had expert knowledge and was an active practitioner in the technology covered by the JSR. Expert Group

17

0

 
0

expert

ppl. adj. «experienced, wise through experience,» s.v. expert a.1 OED. KEY: expert@ppl#adj

18

0

 
0

expert

ppl#adj 6 expert 6

19

0

 
0

expert

a superior player

20

0

 
0

expert

In litigation courts often need to seek from experts information …

21

0

 
0

expert

A person with excellent qualifications and a high degree of attainment in a professional, scientific, technical, or other field. The expert’s knowledge and mastery of the principles, practices, p [..]

22

0

 
0

expert

Another term for a Sotheby’s specialist who is an expert in specific fields of collecting and belongs to a department. Sotheby’s specialists are often scholars with distinguished careers; many of them publish extensively in their field, lecture widely, teach or curate international exhibitions.

Dictionary.university is a dictionary written by people like you and me.
Please help and add a word. All sort of words are welcome!

Add meaning

What do we mean by expert?

A person with a high degree of skill in or knowledge of a certain subject. noun

Having, involving, or demonstrating skill in or knowledge of a certain subject. synonym: proficient. adjective

To experience.

⟨ expert, n. To examine (books, accounts, etc.) as an expert; have examined by an expert: as, the accounts have been experted.

Having had experience; experienced; practised; trained; taught by use, practice, or experience.

Skilful; dexterous; adroit; having facility acquired by practice.

Pertaining to or resulting from experience; due to or proceeding from one having practical knowledge or skill: as, expert workmanship; expert testimony.

Synonyms Adroit, Dexterous, Expert, etc. (see adroit); trained, practised. See skilful.

An experienced, skilful, or practised person; one skilled or thoroughly informed in any particular department of knowledge or art. noun

In law, a person who, by virtue of special acquired knowledge or experience on a subject, presumably not within the knowledge of men generally, may testify in a court of justice to matters of opinion thereon, as distinguished from ordinary witnesses, who can in general testify only to facts. noun

Taught by use, practice, or experience, experienced; having facility of operation or performance from practice; knowing and ready from much practice; clever; skillful adjective

To experience. transitive verb

An expert or experienced person; one instructed by experience; one who has skill, experience, or extensive knowledge in his calling or in any special branch of learning. noun

A specialist in a particular profession or department of science requiring for its mastery peculiar culture and erudition. noun

A sworn appraiser. noun

Extraordinarily capable or knowledgeable. adjective

Characteristic of an expert. adjective

A person with extensive knowledge or ability in a given subject. noun

A player ranking just below master. noun

A person with extensive knowledge or ability in a given subject.

A player ranking just below master.

(1.)Someone Who thinks they knew how to do something but actually just screwed everything up. (2.)Someone who goes into a serious explanation of doing something fairly simple or unimportant like how to drive a bumper car. (3.) When something just doesn’t work how you want it to. (4.) an Idiot…Nub Urban Dictionary

Ex (a former) spurt (a drip under pressure) Urban Dictionary

Someone with a blog or a dude with an opinion. Urban Dictionary

/x, spurt/
«X» in math is an unknown and in plumbing «spurt» is a drip under pressure. Urban Dictionary

A word used by non-experts to make themselves sound like an expert. Has more syllables than the word expertise, thus the speaker attempts to sound more intelligent, but usually fails. Urban Dictionary

A person who knows everything about everything; kent kovalsky Urban Dictionary

A person who learns more and more about less and less until they know everything about very little—at which point, and in every context—they begin to give opinions and tell everyone what they should or should not do. —D.Mar Urban Dictionary

Experting is someone widely recognized as a reliable source of technique or skill whose faculty for judging or deciding rightly, justly, or wisely is accorded authority and status by their peers or the public in a specific well-distinguished domain. Urban Dictionary

A paid shill that often goes on television pretending that they know more than everybody else to promote the false agenda of whoever is paying them. Note: they often sprinkle in facts and figures to confuse the viewer but never give an accurate picture of the issue being discussed. Urban Dictionary

A contract liar Urban Dictionary

Educalingo cookies are used to personalize ads and get web traffic statistics. We also share information about the use of the site with our social media, advertising and analytics partners.

Download the app
educalingo

For every expert that says humans are the cause of ‘climate change’ there are 10 more who say we aren’t.

Bradley A. Blakeman

section

ETYMOLOGY OF THE WORD EXPERT

From Latin expertus known by experience, from experīrī to test.

info

Etymology is the study of the origin of words and their changes in structure and significance.

facebooktwitterpinterestwhatsapp

section

PRONUNCIATION OF EXPERT

facebooktwitterpinterestwhatsapp

GRAMMATICAL CATEGORY OF EXPERT

Expert can act as a noun and an adjective.

A noun is a type of word the meaning of which determines reality. Nouns provide the names for all things: people, objects, sensations, feelings, etc.

The adjective is the word that accompanies the noun to determine or qualify it.

WHAT DOES EXPERT MEAN IN ENGLISH?

Expert

An expert ( pronunciation (US) (help·info)) is someone widely recognized as a reliable source of technique or skill whose faculty for judging or deciding rightly, justly, or wisely is accorded authority and status by peers or the public in a specific well-distinguished domain. An expert, more generally, is a person with extensive knowledge or ability based on research, experience, or occupation and in a particular area of study. Experts are called in for advice on their respective subject, but they do not always agree on the particulars of a field of study. An expert can be believed, by virtue of credential, training, education, profession, publication or experience, to have special knowledge of a subject beyond that of the average person, sufficient that others may officially (and legally) rely upon the individual’s opinion. Historically, an expert was referred to as a sage (Sophos). The individual was usually a profound thinker distinguished for wisdom and sound judgment. Experts have a prolonged or intense experience through practice and education in a particular field.


Definition of expert in the English dictionary

The first definition of expert in the dictionary is a person who has extensive skill or knowledge in a particular field. Other definition of expert is skilful or knowledgeable. Expert is also of, involving, or done by an expert.

WORDS THAT RHYME WITH EXPERT

Synonyms and antonyms of expert in the English dictionary of synonyms

SYNONYMS OF «EXPERT»

The following words have a similar or identical meaning as «expert» and belong to the same grammatical category.

Translation of «expert» into 25 languages

online translator

TRANSLATION OF EXPERT

Find out the translation of expert to 25 languages with our English multilingual translator.

The translations of expert from English to other languages presented in this section have been obtained through automatic statistical translation; where the essential translation unit is the word «expert» in English.

Translator English — Chinese


专家

1,325 millions of speakers

Translator English — Spanish


experto

570 millions of speakers

English


expert

510 millions of speakers

Translator English — Hindi


विशेषज्ञ

380 millions of speakers

Translator English — Arabic


خَبِير

280 millions of speakers

Translator English — Russian


эксперт

278 millions of speakers

Translator English — Portuguese


perito

270 millions of speakers

Translator English — Bengali


বিশেষজ্ঞ

260 millions of speakers

Translator English — French


expert

220 millions of speakers

Translator English — Malay


Pakar

190 millions of speakers

Translator English — German


Experte

180 millions of speakers

Translator English — Japanese


専門家

130 millions of speakers

Translator English — Korean


전문가

85 millions of speakers

Translator English — Javanese


pakar

85 millions of speakers

Translator English — Vietnamese


chuyên gia

80 millions of speakers

Translator English — Tamil


நிபுணர்

75 millions of speakers

Translator English — Marathi


तज्ज्ञ

75 millions of speakers

Translator English — Turkish


uzman

70 millions of speakers

Translator English — Italian


esperto

65 millions of speakers

Translator English — Polish


fachowiec

50 millions of speakers

Translator English — Ukrainian


експерт

40 millions of speakers

Translator English — Romanian


specialist

30 millions of speakers

Translator English — Greek


ειδικός

15 millions of speakers

Translator English — Afrikaans


deskundige

14 millions of speakers

Translator English — Swedish


expert

10 millions of speakers

Translator English — Norwegian


ekspert

5 millions of speakers

Trends of use of expert

TENDENCIES OF USE OF THE TERM «EXPERT»

The term «expert» is very widely used and occupies the 2.314 position in our list of most widely used terms in the English dictionary.

Trends

FREQUENCY

Very widely used

The map shown above gives the frequency of use of the term «expert» in the different countries.

Principal search tendencies and common uses of expert

List of principal searches undertaken by users to access our English online dictionary and most widely used expressions with the word «expert».

FREQUENCY OF USE OF THE TERM «EXPERT» OVER TIME

The graph expresses the annual evolution of the frequency of use of the word «expert» during the past 500 years. Its implementation is based on analysing how often the term «expert» appears in digitalised printed sources in English between the year 1500 and the present day.

Examples of use in the English literature, quotes and news about expert

10 QUOTES WITH «EXPERT»

Famous quotes and sentences with the word expert.

Mohammed Hussein Al Amoudi

I make a personal commitment to the direction and success of all the programs in which I invest. I make all major philanthropic decisions myself after taking account of a range of expert opinion.

The people who make policy decisions should damned well know what they are talking about before they make the decisions. There is nobody who is an expert on cloning who would be afraid after seeing Attack of the Clones.

If stock market experts were so expert, they would be buying stock, not selling advice.

If an expert says it can’t be done, get another expert.

I’m no expert standing at a podium giving speeches. I share heartbeats. Compassion.

For every expert that says humans are the cause of ‘climate change’ there are 10 more who say we aren’t.

I am an expert in the ‘art of the possible.’

Cooking is like anything else: some people have an inborn talent for it. Some become expert by practicing, and some learn from books.

These doomsday warriors look no more like soldiers than the soldiers of the Second World War looked like conquistadors. The more expert they become the more they look like lab assistants in small colleges.

I became a larger than life figure for one reason only. When you’re quoted in the ‘Wall Street Journal’, the ‘New York Times’, constantly as the expert in the business people assume you’re a lot bigger than you are. And then I had to run like hell to catch up with my own image.

10 ENGLISH BOOKS RELATING TO «EXPERT»

Discover the use of expert in the following bibliographical selection. Books relating to expert and brief extracts from same to provide context of its use in English literature.

1

The New Vegetable & Herb Expert

There can be no fresher tasting vegetables or herbs than the ones you’ve grown yourself.

2

Be Expert with Map and Compass

It features: Clear, concise instructions for using a map and compass effectively Exercises to help you learn and practice your orienteering skills An introduction to the basics of competitive orienteering Useful references for further …

Bjorn Kjellstrom, Carina Kjellstrom Elgin, 2009

3

Expert Political Judgment: How Good Is It? How Can We Know?

This book fills that need. Here, Philip E. Tetlock explores what constitutes good judgment in predicting future events, and looks at why experts are often wrong in their forecasts.

4

Expert Systems: The User Interface

This text takes a broad view of the work going on in the development of user interfaces for expert systems and examines the expert system building process both in academic and industrial surroundings.

5

The Cambridge Handbook of Expertise and Expert Performance

This 2006 book was the first handbook where the world’s foremost ‘experts on expertise’ reviewed our scientific knowledge on expertise and expert performance and how experts may differ from non-experts in terms of their development, …

K. Anders Ericsson, Neil Charness, Paul J. Feltovich, 2006

6

Expert Systems and Related Topics: Selected Bibliography and …

Whether you are a manager, a developer or an end user or researcher, Expert Systems and Related Topics: Selected Bibliography & Guide to Information Sources puts all the sources of expert systems literature at your fingertips.

7

Expert Systems and Probabilistic Network Models

This book is devoted to providing a thorough and up-to-date survey of this field for researchers and students.

8

Fuzzy Sets, Decision Making, and Expert Systems

This volume tried to cover fuzzy set theory and its applications as extensively as possible. Applications could, therefore, only be described to a limited extent and not very detailed.

Hans-Jürgen Zimmermann, 1987

9

Artificial Intelligence and Expert Systems for Engineers

This book provides a comprehensive presentation of artificial intelligence (AI) methodologies and tools valuable for solving a wide spectrum of engineering problems.

C.S. Krishnamoorthy, S. Rajeev, 1996

10

Expert systems: artificial intelligence in business

Looks how expert systems solve problems, represent knowledge, and draw inferences, describes specific systems of artificial intelligence, and identifies the markets for expert systems

Paul Harmon, David King, 1985

10 NEWS ITEMS WHICH INCLUDE THE TERM «EXPERT»

Find out what the national and international press are talking about and how the term expert is used in the context of the following news items.

How to build a reputation as an expert

Dear Annie: I’m working on an MBA in finance and, as part of a class project, I came up with a new way of valuing companies for IPOs or … «Fortune, Jul 15»

Expert team to investigate death of four babies at KIMS

A day after four babies died at the NICU in Kempegowda Institute of Medical Sciences (KIMS), Department of Health and Family Welfare … «The Hindu, Jul 15»

James Holmes Murder Trial: Schizophrenia Expert Testifies That …

For the past three days, an expert on schizophrenia has testified that the shooting could be directly traced to Holmes’ mental illness. «I find no … «People Magazine, Jul 15»

Expert System Enhances Search Solution for Oil, Gas Big Data

Expert System, which provides semantic solutions for the oil and gas industry, recently reported it would enhance the features of its flagship … «Rigzone, Jul 15»

The Expert View: National Grid, Barratt Developments and ABF

If you would like to receive news alerts on any of the stocks mentioned in The Expert View, click on the star icons below to add them to your … «Citywire.co.uk, Jul 15»

Chess expert, 13, wins scholarship to Brighton College

Teenage chess expert Dominic Miller is already an award-winning player who plays in the National Junior Chess squad but is now being … «Telegraph.co.uk, Jul 15»

Expert Reveals the Latest Variable Capacity Technology

Cooling data centers and other mission-critical environments is an ever-changing challenge. Doing so in an energy efficient manner is an even … «Data Center Knowledge, Jul 15»

EXCLUSIVE! Relationship Expert Dr. V Is Back To Break Down …

And with all the questions concerning their lost love, we once again turn to Relationship Expert Dr. V to shed some light on the situation, and … «PerezHilton.com, Jul 15»

Expert testifies against cancer doctor Fata: Patient records ‘disturbing’

An expert who looked at the files of 100 patients of a Detroit-area cancer doctor said the records are «disturbing.» Dr. David Steensma … «Crain’s Detroit Business, Jul 15»

Casement Park inquiry: Stadium safety expert makes new pressure …

Stadium safety expert Paul Scott has made new claims about pressure allegedly put on him behind the scenes over the Casement Park project. «BBC News, Jul 15»

REFERENCE

« EDUCALINGO. Expert [online]. Available <https://educalingo.com/en/dic-en/expert>. Apr 2023 ».

Download the educalingo app


Discover all that is hidden in the words on educalingo

  • Defenition of the word expert

    • Showing knowledge and skill and aptitude in performing some activity.
    • A very knowledgeable person in a particular area or subject.
    • having or showing knowledge and skill and aptitude; «adept in handicrafts»; «an adept juggler»; «an expert job»; «a good mechanic»; «a practiced marksman»; «a proficient engineer»; «a lesser-known but no less skillful composer»; «the effect was achieved by skillful retouching»
    • having or showing great skill or knowledge or special training as expected of a professional; «an expert opinion»
    • a person who performs skillfully
    • a person with special knowledge or ability who performs skillfully
    • having or showing knowledge and skill and aptitude; «adept in handicrafts»; «an adept juggler»; «an expert job»; «a good mechanic»; «a practiced marksman»; «a proficient engineer»; «a lesser-known but no less skillful composer»; «the effect was achieved b
    • having or showing knowledge and skill and aptitude
    • of or relating to or requiring special knowledge to be understood

Synonyms for the word expert

    • adept
    • authority
    • connoisseur
    • good
    • knowledgeable
    • practiced
    • professional
    • proficient
    • skilful
    • skilled
    • skillful
    • specialist

Similar words in the expert

    • expert
    • expert’s
    • expertly
    • expertness
    • expertness’s
    • experts
    • professional
    • skilled

Hyponyms for the word expert

    • ace
    • adept
    • agronomist
    • all arounder
    • all-rounder
    • analyst
    • anatomist
    • antiquarian
    • antiquary
    • arbiter
    • archaist
    • archer
    • authority
    • black belt
    • bowman
    • cabalist
    • calculator
    • champion
    • climatologist
    • commentator
    • computer
    • computer expert
    • computer guru
    • cosmetologist
    • efficiency engineer
    • efficiency expert
    • estimator
    • exegete
    • figurer
    • genealogist
    • genius
    • geographer
    • guide
    • healer
    • horticulturist
    • hotshot
    • investigator
    • jurist
    • kabbalist
    • lapidarist
    • lapidary
    • legal expert
    • logician
    • logistician
    • maven
    • mavin
    • mnemonist
    • mythologist
    • nerd
    • observer
    • old hand
    • old stager
    • old-timer
    • oldtimer
    • out-and-outer
    • parliamentarian
    • past master
    • pathfinder
    • plantsman
    • prosthetist
    • pteridologist
    • reckoner
    • scout
    • sensation
    • shark
    • shooter
    • shot
    • specialiser
    • specialist
    • specializer
    • stager
    • star
    • superstar
    • supreme authority
    • talent
    • technician
    • technocrat
    • therapist
    • veteran
    • virtuoso
    • warhorse
    • whiz
    • whizz
    • wiz
    • wizard

Hypernyms for the word expert

    • human
    • individual
    • mortal
    • person
    • somebody
    • someone
    • soul

See other words

    • What is dyed-in-the-wool
    • The definition of unquestionable
    • The interpretation of the word well-defined
    • What is meant by convinced
    • The lexical meaning crystal-clear
    • The dictionary meaning of the word incurable
    • The grammatical meaning of the word hardened
    • Meaning of the word jobs
    • Literal and figurative meaning of the word viper
    • The origin of the word proficient
    • Synonym for the word positives
    • Antonyms for the word practiced
    • Homonyms for the word authoritatively
    • Hyponyms for the word skilled
    • Holonyms for the word qualified
    • Hypernyms for the word pretentiousness
    • Proverbs and sayings for the word promoter
    • Translation of the word in other languages prim and proper

Понравилась статья? Поделить с друзьями:

А вот еще интересные статьи:

  • Definition of the word expect
  • Definition of the word exhibition
  • Definition of the word executive
  • Definition of the word exacting
  • Definition of the word evolution

  • 0 0 голоса
    Рейтинг статьи
    Подписаться
    Уведомить о
    guest

    0 комментариев
    Старые
    Новые Популярные
    Межтекстовые Отзывы
    Посмотреть все комментарии